ATP10D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159982

Catalog No. NBP159982

Description

ATP10D Polyclonal specifically detects ATP10D in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATP10D
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATPase, class V, type 10D, ATPVDtype IV aminophospholipid transporting ATPase, EC 3.6.3, EC 3.6.3.1, KIAA1487ATPase class V type 10D, probable phospholipid-transporting ATPase VD
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57205
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9P241
• Gene Symbols: ATP10D
• Immunogen: Synthetic peptides corresponding to ATP10D(ATPase, class V, type 10D) The peptide sequence was selected from the C terminal of ATP10D. Peptide sequence LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 92%; Equine: 92%; Pig: 92%; Canine: 91%; Rabbit: 91%; Bovine: 85%; Mouse: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG