Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP4A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317134100UL
This item is not returnable.
View return policy
Description
ATP4A Polyclonal antibody specifically detects ATP4A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ATP4A | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ATP6Agastric H, ATPase, H+/K+ exchanging, alpha polypeptide, ATPase, H+/K+ transporting, alpha polypeptide, EC 3.6.3, EC 3.6.3.10, gastric H, Gastric H(+)/K(+) ATPase subunit alpha, gastric H+/K+ ATPase alpha subunit, gastric hydrogen-potassium ATPase, H(+)-K(+)-ATPase alpha subunit, K-ATPase alpha subunit, K-ATPase catalytic subunit, potassium-transporting ATPase alpha chain 1, Proton pump | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSATKGLSASLAAELLLRD | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 495 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction