Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATP5F1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154702 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154702 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154702 Supplier Novus Biologicals Supplier No. NBP154702
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ATP5F1 Polyclonal specifically detects ATP5F1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ATP5F1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P24539
Gene Alias ATP synthase B chain, mitochondrial, ATP synthase subunit b, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1, ATPase subunit b, cell proliferation-inducing protein 47, H+-ATP synthase subunit b, MGC24431, PIG47
Gene Symbols ATP5PB
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ATP5F1(ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1) The peptide sequence was selected from the middle region of ATP5F1. Peptide sequence VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 25 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 515
Test Specificity This product is specific to Subunit or Isoform: b, mitochondrial.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.