ATP5S Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257311

Catalog No. NBP257311

Description

ATP5S Polyclonal specifically detects ATP5S in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ATP5S
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ATP synthase coupling factor B-like 1, ATP synthase subunit s, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit s (factor B), ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B), ATP synthase-coupling factor B, ATPWATP synthase coupling factor B, mitochondrial, HSU79253, Mitochondrial ATP synthase regulatory component factor B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27109
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ATP5S
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDC
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only