ATP6AP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157020

Catalog No. NBP157020

Description

ATP6AP1 Polyclonal specifically detects ATP6AP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATP6AP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 16A, Ac45, ATP6IP1V-ATPase subunit S1, ATP6S1ORF, ATPase, H+ transporting, lysosomal (vacuolar proton pump), subunit 1, ATPase, H+ transporting, lysosomal accessory protein 1, H+ transporting, lysosomal interacting protein 1, H-ATPase subunit, MGC129781, Protein XAP-3, Vacuolar proton pump subunit S1, VATPS1V-ATPase Ac45 subunit, V-type proton ATPase subunit S1, XAP-3, XAP3V-ATPase S1 accessory protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 537
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q15904
• Gene Symbols: ATP6AP1
• Immunogen: Synthetic peptides corresponding to ATP6AP1 (ATPase, H+ transporting, lysosomal accessory protein 1) The peptide sequence was selected from the middle region of ATP6AP1. Peptide sequence SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG