ATP6V0A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP189342

Catalog No. NBP189342

Description

ATP6V0A1 Polyclonal specifically detects ATP6V0A1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP6V0A1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: a1, ATP6N1, ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD), ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD), ATPase, H+ transporting, lysosomal V0 subunit a isoform 1, ATPase, H+ transporting, lysosomal V0 subunit a1, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, DKFZp781J1951, Stv1, Vacuolar adenosine triphosphatase subunit Ac116, Vacuolar proton pump subunit 1, vacuolar proton pump, subunit 1, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, vacuolar-type H(+)-ATPase 115 kDa subunit, V-ATPase 116 kDa, V-ATPase 116 kDa isoform a1, Vph1, VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 535
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ATP6V0A1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human ATP6V0A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only