ATP6V0A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159069

Catalog No. NBP159069

Description

ATP6V0A2 Polyclonal antibody specifically detects ATP6V0A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: ATP6V0A2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: A2, ARCL, ATP6a2, ATP6N1D, ATP6V0, ATPase, H+ transporting, lysosomal V0 subunit a isoform 2, ATPase, H+ transporting, lysosomal V0 subunit a2, infantile malignant osteopetrosis, J6B7, Lysosomal H(+)-transporting ATPase V0 subunit a2, regeneration and tolerance factor, RTF, STV1, TJ6A2V-ATPase, TJ6M, TJ6S, vacuolar proton translocating ATPase 116 kDa subunit a, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2, v-ATPase 116 kDa, V-ATPase 116 kDa isoform a2, Vph1, v-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 2, WSS
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23545
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9Y487
• Gene Symbols: ATP6V0A2
• Immunogen: Synthetic peptides corresponding to ATP6V0A2(ATPase, H+ transporting, lysosomal V0 subunit a2) The peptide sequence was selected from the N terminal of ATP6V0A2. Peptide sequence INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: a isoform 2.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Yeast, Zebrafish
• Isotype: IgG

For Research Use Only