Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ATP6V0E2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ATP6V0E2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NBP155100 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155100 100 μL
NBP155120UL 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP155100 Supplier Novus Biologicals Supplier No. NBP155100

Description

Rabbit Polyclonal Antibody

ATP6V0E2 Polyclonal specifically detects ATP6V0E2 in Human samples. It is validated for Western Blot.

Specifications

Antigen ATP6V0E2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias ATP6V0, ATPase, H+ transporting V0 subunit e2, chromosome 7 open reading frame 32, H+ transporting V0 subunit E isoform 2-like (rat), Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2
Gene Symbols ATP6V0E2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ATP6V0E2(ATPase, H+ transporting V0 subunit e2) The peptide sequence was selected from the middle region of ATP6V0E2. Peptide sequence TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP.
Molecular Weight of Antigen 17-19 kDa
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 155066
Test Specificity This product is specific to isoforms 2 and 3 of ATP6V0E2 (Uniprot: Q8NHE4-2, Q8NHE4-3).
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.