ATP6V1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25516425UL

Catalog No. NB395138

Description

ATP6V1A Polyclonal antibody specifically detects ATP6V1A in Human, Canine samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.

Specifications

• Antigen: ATP6V1A
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: 70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 523
• Target Species: Human, Canine
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ATP6V1A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only