Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP6V1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ATP6V1A |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ATP6V1A Polyclonal antibody specifically detects ATP6V1A in Human, Canine samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.Specifications
ATP6V1A | |
Polyclonal | |
Rabbit | |
Human, Canine | |
70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A | |
ATP6V1A | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
523 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title