ATP6V1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP255164	Novus Biologicals NBP255164	100 μL
NB395138	Novus Biologicals NBP25516425UL	25 μL

Description

ATP6V1A Polyclonal antibody specifically detects ATP6V1A in Human, Canine samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.

Specifications

• Antigen: ATP6V1A
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Canine
• Gene Alias: 70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
• Gene Symbols: ATP6V1A
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 523
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only