ATP6V1B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233962

Catalog No. NBP233962

Description

ATP6V1B1 Polyclonal specifically detects ATP6V1B1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP6V1B1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P15313
• Gene Symbols: ATP6V1B1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATP6B158kD subunit, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1, Endomembrane proton pump 58 kDa subunit, H+-ATPase beta 1 subunit, vacuolar proton pump 3, Vacuolar proton pump subunit B 1, vacuolar proton pump, subunit 3, VATBMGC32642, V-ATPase B1 subunit, V-ATPase subunit B 1, Vma2, V-type proton ATPase subunit B, kidney isoform
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 525
• Target Species: Human
• Isotype: IgG

For Research Use Only