Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP6V1B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ATP6V1B1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ATP6V1B1 Polyclonal specifically detects ATP6V1B1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ATP6V1B1 | |
Polyclonal | |
Rabbit | |
Human | |
P15313 | |
525 | |
This antibody was developed against a recombinant protein corresponding to amino acids: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ATP6B158kD subunit, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1, Endomembrane proton pump 58 kDa subunit, H+-ATPase beta 1 subunit, vacuolar proton pump 3, Vacuolar proton pump subunit B 1, vacuolar proton pump, subunit 3, VATBMGC32642, V-ATPase B1 subunit, V-ATPase subunit B 1, Vma2, V-type proton ATPase subunit B, kidney isoform | |
ATP6V1B1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title