Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATP6V1B2 Antibody, Novus Biologicals™
SDP

Catalog No. NB431047 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB431047 25 μL
NBP188890 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB431047 Supplier Novus Biologicals Supplier No. NBP18889025UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ATP6V1B2 Polyclonal specifically detects ATP6V1B2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen ATP6V1B2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 000 subunit, 56/58kD, isoform 2, ATP6B2ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2, Endomembrane proton pump 58 kDa subunit, H+ transporting two-sector ATPase, HO57ATP6B1B2, vacuolar H+-ATPase 56, Vacuolar proton pump subunit B 2, VATB, V-ATPase B2 subunit, V-ATPase subunit B 2, Vma2, VPP3ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2, V-type proton ATPase subunit B, brain isoform
Gene Symbols ATP6V1B2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 526
Test Specificity Specificity of human ATP6V1B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.