ATP6V1C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26885425UL

Catalog No. NB392859

Description

ATP6V1C2 Polyclonal antibody specifically detects ATP6V1C2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ATP6V1C2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: ATP6C2, ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2, Vacuolar proton pump subunit C 2, V-ATPase C2 subunit, V-ATPase subunit C 2, VMA5, V-type proton ATPase subunit C 2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 245973
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG