Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP6V1C2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | ATP6V1C2 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ATP6V1C2 Polyclonal antibody specifically detects ATP6V1C2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ATP6V1C2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ATP6C2, ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2, Vacuolar proton pump subunit C 2, V-ATPase C2 subunit, V-ATPase subunit C 2, VMA5, V-type proton ATPase subunit C 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 245973 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title