ATP6V1E2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15460120UL

Catalog No. NBP1546020

Description

ATP6V1E2 Polyclonal specifically detects ATP6V1E2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATP6V1E2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q96A05
• Gene Symbols: ATP6V1E2
• Immunogen: Synthetic peptides corresponding to ATP6V1E2(ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2) The peptide sequence was selected from the middle region of ATP6V1E2. Peptide sequence LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90423
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP6E1V-ATPase subunit E 2, ATP6EL2, ATP6V1EL2, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD-like 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2, MGC9341, Vacuolar proton pump subunit E 2, vacuolar-type proton-translocating ATPase subunit E1, VMA4, V-type proton ATPase subunit E 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: E 2.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.