Learn More
Description
Specifications
Specifications
| Antigen | ATP6V1G1 |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | ATP6G1V-ATPase 13 kDa subunit 1, ATP6GATP6J, ATP6GL, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member J, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 1, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1, DKFZp547P234, vacuolar ATP synthase subunit M16, vacuolar H(+)-ATPase subunit G 1, Vacuolar proton pump subunit G 1, Vacuolar proton pump subunit M16, V-ATPase subunit G 1, Vma10, V-type proton ATPase subunit G 1 |
| Gene Symbols | ATP6V1G1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
