ATP6V1G3 Antibody, Novus Biologicals™

Catalog No.	Quantity
NB431045	25 μL
NBP188894	0.1 mL

Catalog No. NB431045 Supplier Novus Biologicals Supplier No. NBP18889425UL

Description

Rabbit Polyclonal Antibody

ATP6V1G3 Polyclonal specifically detects ATP6V1G3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP6V1G3
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3, H+ transporting, lysosomal (vacuolar proton pump) subunit G3, MGC119810, MGC119813, vacuolar ATP synthase subunit G 3, vacuolar proton pump G subunit 3, Vacuolar proton pump subunit G 3, vacuolar proton pump, subunit G3, V-ATPase 13 kDa subunit 3, V-ATPase G subunit 3, V-ATPase G3 subunit, V-ATPase subunit G 3, V-type proton ATPase subunit G 3
• Gene Symbols: ATP6V1G3
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR
• Purification Method: Affinity Purified
• Quantity: 25 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 127124
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only