ATP6V1G3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188894

Catalog No. NBP188894

Description

ATP6V1G3 Polyclonal specifically detects ATP6V1G3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP6V1G3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
• Gene Alias: ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3, H+ transporting, lysosomal (vacuolar proton pump) subunit G3, MGC119810, MGC119813, vacuolar ATP synthase subunit G 3, vacuolar proton pump G subunit 3, Vacuolar proton pump subunit G 3, vacuolar proton pump, subunit G3, V-ATPase 13 kDa subunit 3, V-ATPase G subunit 3, V-ATPase G3 subunit, V-ATPase subunit G 3, V-type proton ATPase subunit G 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 127124
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ATP6V1G3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only