ATP6V1G3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB431045	Novus Biologicals NBP18889425UL	25 μL
NBP188894	Novus Biologicals NBP188894	0.1 mL

Description

ATP6V1G3 Polyclonal specifically detects ATP6V1G3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP6V1G3
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 127124
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3, H+ transporting, lysosomal (vacuolar proton pump) subunit G3, MGC119810, MGC119813, vacuolar ATP synthase subunit G 3, vacuolar proton pump G subunit 3, Vacuolar proton pump subunit G 3, vacuolar proton pump, subunit G3, V-ATPase 13 kDa subunit 3, V-ATPase G subunit 3, V-ATPase G3 subunit, V-ATPase subunit G 3, V-type proton ATPase subunit G 3
• Gene Symbols: ATP6V1G3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only