ATP8B4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188907

Catalog No. NBP188907

Description

ATP8B4 Polyclonal specifically detects ATP8B4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP8B4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ATP8B4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHNLMESIKMGDPKVHEFLR
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.2mg/mL
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ATPase class I type 8B member 4, ATPase, class I, type 8B, member 4, ATPIM, EC 3.6.3, EC 3.6.3.1, FLJ25418, KIAA1939, potential phospholipid-transporting ATPase IM, probable phospholipid-transporting ATPase IM
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79895
• Target Species: Human
• Isotype: IgG

For Research Use Only