ATPase Na+/K+ beta 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310586100UL

Catalog No. NB126073

Description

ATPase Na+/K+ beta 2 Polyclonal specifically detects ATPase Na+/K+ beta 2 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Frozen.

Specifications

• Antigen: ATPase Na+/K+ beta 2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Frozen
• Gene Alias: adhesion molecule on glia, AMOGsodium/potassium-dependent ATPase beta-2 subunit, ATPase, Na+/K+ transporting, beta 2 polypeptide, Na, K-ATPase beta-2 polypeptide, Sodium/potassium-dependent ATPase subunit beta-2, sodium/potassium-transporting ATPase beta-2 chain, sodium/potassium-transporting ATPase subunit beta-2
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_038201). Peptide sequence WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Frozen)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 482
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.