Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATPase Na+/K+ beta 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ATPase Na+/K+ beta 2 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Frozen |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Frozen) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ATPase Na+/K+ beta 2 Polyclonal specifically detects ATPase Na+/K+ beta 2 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Frozen.Specifications
ATPase Na+/K+ beta 2 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Frozen) | |
Unconjugated | |
Rabbit | |
Mouse | |
adhesion molecule on glia, AMOGsodium/potassium-dependent ATPase beta-2 subunit, ATPase, Na+/K+ transporting, beta 2 polypeptide, Na, K-ATPase beta-2 polypeptide, Sodium/potassium-dependent ATPase subunit beta-2, sodium/potassium-transporting ATPase beta-2 chain, sodium/potassium-transporting ATPase subunit beta-2 | |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_038201). Peptide sequence WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Frozen | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
482 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title