ATPase Na+/K+ beta 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23859525UL

Catalog No. NB396750

Description

ATPase Na+/K+ beta 3 Polyclonal specifically detects ATPase Na+/K+ beta 3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATPase Na+/K+ beta 3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P54709
• Gene Symbols: ATP1B3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATPase, Na+/K+ transporting, beta 3 polypeptide, ATPB-3, CD298, CD298 antigen, FLJ29027, Na, K-ATPase beta-3 polypeptide, sodium/potassium-dependent ATPase beta-3 subunit, Sodium/potassium-dependent ATPase subunit beta-3, sodium/potassium-transporting ATPase beta-3 chain, sodium/potassium-transporting ATPase subunit beta-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 483
• Target Species: Human
• Isotype: IgG