Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATPase Na+/K+ beta 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | ATPase Na+/K+ beta 3 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ATPase Na+/K+ beta 3 Polyclonal specifically detects ATPase Na+/K+ beta 3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ATPase Na+/K+ beta 3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P54709 | |
| 483 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATPase, Na+/K+ transporting, beta 3 polypeptide, ATPB-3, CD298, CD298 antigen, FLJ29027, Na, K-ATPase beta-3 polypeptide, sodium/potassium-dependent ATPase beta-3 subunit, Sodium/potassium-dependent ATPase subunit beta-3, sodium/potassium-transporting ATPase beta-3 chain, sodium/potassium-transporting ATPase subunit beta-3 | |
| ATP1B3 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title