ATPG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP234138

Catalog No. NBP234138

Description

ATPG Polyclonal specifically detects ATPG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATPG
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P36542
• Gene Symbols: ATP5F1C
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATP synthase gamma chain, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1, ATP5CATP synthase subunit gamma, mitochondrial, ATP5CL1mitochondrial ATP synthase, gamma subunit 1, F-ATPase gamma subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 509
• Target Species: Human
• Isotype: IgG

For Research Use Only