ATR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP27654725UL

Catalog No. NB402741

Description

ATR Polyclonal specifically detects ATR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ATR
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: ataxia telangiectasia and Rad3 related, Ataxia telangiectasia and Rad3-related protein, EC 2.7.11.1, FRAP-related protein 1, FRP1FRAP-related protein-1, MEC1, protein kinase ATR, Rad3 related protein, SCKL1, SCKLMEC1, mitosis entry checkpoint 1, homolog, serine/threonine-protein kinase ATR
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: ATR
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK
• Quantity: 25 μL
• Research Discipline: Breast Cancer, Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Immunology, p53 Pathway, Virology Bacteria and Parasites
• Gene ID (Entrez): 545.0
• Target Species: Human
• Form: Purified