AUH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15737520UL

Catalog No. NBP15737520

Description

AUH Polyclonal specifically detects AUH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AUH
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q13825
• Gene Symbols: AUH
• Immunogen: Synthetic peptides corresponding to AUH (AU RNA binding protein/enoyl-Coenzyme A hydratase) The peptide sequence was selected from the C terminal of AUH. Peptide sequence IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: 3-methylglutaconyl-CoA hydratase, AU RNA binding protein/enoyl-CoA hydratase, AU RNA binding protein/enoyl-Coenzyme A hydratase, AU RNA-binding protein/enoyl-Coenzyme A hydratase, AU-binding protein/enoyl-CoA hydratase, AU-specific RNA-binding enoyl-CoA hydratase, EC 4.2.1.18, methylglutaconyl-CoA hydratase, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 549
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.