Aurora C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15499420UL

Catalog No. NBP15499420

Description

Aurora C Polyclonal specifically detects Aurora C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Aurora C
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q9UQB9
• Gene Symbols: AURKC
• Immunogen: Synthetic peptides corresponding to AURKC(aurora kinase C) The peptide sequence was selected from the middle region of AURKC. Peptide sequence TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AIE2AIK3, ARK3Serine/threonine-protein kinase aurora-C, AurC, aurora kinase CAurora/IPL1/Eg2 protein 2, Aurora/IPL1-related kinase 3, aurora-C, Aurora-related kinase 3, EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 13 (aurora/IPL1-like), serine/threonine-protein kinase 13, STK13ARK-3
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 20 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 6795
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.