Aurora C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP19081925UL

Catalog No. NB418061

Description

Aurora C Polyclonal specifically detects Aurora C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aurora C
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: AIE2AIK3, ARK3Serine/threonine-protein kinase aurora-C, AurC, aurora kinase CAurora/IPL1/Eg2 protein 2, Aurora/IPL1-related kinase 3, aurora-C, Aurora-related kinase 3, EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 13 (aurora/IPL1-like), serine/threonine-protein kinase 13, STK13ARK-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: AURKC
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 6795
• Target Species: Human
• Isotype: IgG

For Research Use Only