Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aurora C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Aurora C |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Aurora C Polyclonal specifically detects Aurora C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Aurora C | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| AIE2AIK3, ARK3Serine/threonine-protein kinase aurora-C, AurC, aurora kinase CAurora/IPL1/Eg2 protein 2, Aurora/IPL1-related kinase 3, aurora-C, Aurora-related kinase 3, EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 13 (aurora/IPL1-like), serine/threonine-protein kinase 13, STK13ARK-3 | |
| AURKC | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6795 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title