Axl Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238345

Catalog No. NBP238345

Description

Axl Polyclonal specifically detects Axl in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Axl
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P30530
• Gene Symbols: AXL
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 558
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AXL oncogene, AXL receptor tyrosine kinase, AXL transforming sequence/gene, EC 2.7.10, EC 2.7.10.1, JTK11, tyrosine-protein kinase receptor UFO, UFOoncogene AXL
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.