B3GALNT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157930

Catalog No. NBP157930

Description

B3GALNT2 Polyclonal specifically detects B3GALNT2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: B3GALNT2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B3GalNAc-T2, beta 1,3-N-acetylgalactosaminyltransferase-II (MGC39558), beta-1,3-galactosaminyltransferase 2, Beta-1,3-GalNAc-T2, beta-1,3-N-acetylgalactosaminyltransferase 2, Beta-1,3-N-acetylgalactosaminyltransferase II, EC 2.4.1, EC 2.4.1.-, MGC39558, UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2, UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 148789
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NCR0
• Gene Symbols: B3GALNT2
• Immunogen: Synthetic peptides corresponding to B3GALNT2(beta-1,3-N-acetylgalactosaminyltransferase 2) The peptide sequence was selected from the middle region of B3GALNT2. Peptide sequence PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Rabbit: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG