Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
B3GALNT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | B3GALNT2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
B3GALNT2 Polyclonal specifically detects B3GALNT2 in Human samples. It is validated for Western Blot.Specifications
B3GALNT2 | |
Polyclonal | |
Rabbit | |
Q8NCR0 | |
148789 | |
Synthetic peptides corresponding to B3GALNT2(beta-1,3-N-acetylgalactosaminyltransferase 2) The peptide sequence was selected from the middle region of B3GALNT2. Peptide sequence PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
B3GalNAc-T2, beta 1,3-N-acetylgalactosaminyltransferase-II (MGC39558), beta-1,3-galactosaminyltransferase 2, Beta-1,3-GalNAc-T2, beta-1,3-N-acetylgalactosaminyltransferase 2, Beta-1,3-N-acetylgalactosaminyltransferase II, EC 2.4.1, EC 2.4.1.-, MGC39558, UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2, UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 2 | |
B3GALNT2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title