Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16237520

B3GALT6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16237520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16237520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16237520 Supplier Novus Biologicals Supplier No. NBP16237520UL

Description

Rabbit Polyclonal Antibody

B3GALT6 Polyclonal specifically detects B3GALT6 in Human samples. It is validated for Western Blot.

Specifications

Antigen B3GALT6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96L58
Gene Alias beta-1,3-galactosyltransferase 6, Beta-1,3-GalTase 6, Beta3GalT6, Beta3Gal-T6, EC 2.4.1.134, Galactosyltransferase II, Galactosylxylosylprotein 3-beta-galactosyltransferase, UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6GAG GalTII, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6
Gene Symbols B3GALT6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) The peptide sequence was selected form the C terminal of B3GALT6. Peptide sequence VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 126792
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.