B3GALT6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169396

Catalog No. NBP169396

Description

B3GALT6 Polyclonal specifically detects B3GALT6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: B3GALT6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: beta-1,3-galactosyltransferase 6, Beta-1,3-GalTase 6, Beta3GalT6, Beta3Gal-T6, EC 2.4.1.134, Galactosyltransferase II, Galactosylxylosylprotein 3-beta-galactosyltransferase, UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6GAG GalTII, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96L58
• Gene Symbols: B3GALT6
• Immunogen: Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) The peptide sequence was selected from the C terminal of B3GALT6. Peptide sequence VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126792
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only