B3GAT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168910

Catalog No. NBP168910

Description

B3GAT2 Polyclonal specifically detects B3GAT2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: B3GAT2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Beta-1,3-glucuronyltransferase 2, beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S), EC 2.4.1.135, GlcAT-D, GlcAT-S, GLCATSgalactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2, Glucuronosyltransferase S, KIAA1963glcAT-D, MGC138535, UDP-glucuronosyltransferase S, UDP-glucuronyltransferase S, uridine diphosphate glucuronic acid:acceptor glucuronosyltransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P59270
• Gene Symbols: B3GAT2
• Immunogen: Synthetic peptides corresponding to B3gat2 (beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)) The peptide sequence was selected from the C terminal of B3gat2. Peptide sequence SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 135152
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG