B4GALNT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162535

Catalog No. NBP162535

Description

B4GALNT1 Polyclonal specifically detects B4GALNT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: B4GALNT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: (N-acetylneuraminyl)-galactosylglucosylceramide, beta-1,4 N-acetylgalactosaminyltransferase 1, beta1,4GalNAc-T, beta-1,4-N-acetyl-galactosaminyl transferase 1, beta1-4GalNAc-T, GALGTEC 2.4.1.92, GalNAc-T, GALNACT, GD2 synthase, GM2 synthase, GM2/GD2 synthase, SIAT2, UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1, UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramideN-acetylgalactosaminyltransferase (GalNAc-T)
• Host Species: Rabbit
• Molecular Weight of Antigen: 59 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q00973
• Gene Symbols: B4GALNT1
• Immunogen: Synthetic peptides corresponding to B4GALNT1(beta-1,4-N-acetyl-galactosaminyl transferase 1) The peptide sequence was selected from the N terminal of B4GALNT1. Peptide sequence APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2583
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG