B4GALT6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP237967

Catalog No. NBP237967

Description

B4GALT6 Polyclonal specifically detects B4GALT6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: B4GALT6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q9UBX8
• Gene Symbols: B4GALT6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 9331
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: B4Gal-T6, beta-1,4-galactosyltransferase 6, Beta-1,4-GalTase 6, Beta4Gal-T6, beta4GalT-VI, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.