Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
B4GALT6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | B4GALT6 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
B4GALT6 Polyclonal specifically detects B4GALT6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
B4GALT6 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q9UBX8 | |
9331 | |
This antibody was developed against a recombinant protein corresponding to amino acids: TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
B4Gal-T6, beta-1,4-galactosyltransferase 6, Beta-1,4-GalTase 6, Beta4Gal-T6, beta4GalT-VI, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6 | |
B4GALT6 | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title