B7-2/CD86 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP32124525UL

Catalog No. NB236286

Description

B7-2/CD86 Polyclonal antibody specifically detects B7-2/CD86 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: B7-2/CD86
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: Activation B7-2 antigen, B70, B7-2, B7-2 antigen, B-lymphocyte activation antigen B7-2, BU63, CD28 antigen ligand 2, CD28LG2B7-2 antigen), CD86 antigen, CD86 molecule, CTLA-4 counter-receptor B7.2, FUN-1, LAB72, MGC34413, T-lymphocyte activation antigen CD86
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GTNTMEREESEQTKKREKIHIPERSDEAQRV
• Quantity: 25 μg
• Research Discipline: Adaptive Immunity, B Cell Development and Differentiation Markers, Cell Cycle and Replication, Dendritic Cell Markers, Diabetes Research, Immunology, Inflammation, Myeloid derived Suppressor Cell, Signal Transduction
• Gene ID (Entrez): 942
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified