Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

B7-2/CD86 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$330.00 - $547.00

Specifications

Antigen	B7-2/CD86
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Applications	Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB236286 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP32124525UL	25 μg	Each for $330.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB239054 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP321245100UL	100 μg	Each for $547.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

B7-2/CD86 Polyclonal antibody specifically detects B7-2/CD86 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	B7-2/CD86
Applications	Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Adaptive Immunity, B Cell Development and Differentiation Markers, Cell Cycle and Replication, Dendritic Cell Markers, Diabetes Research, Immunology, Inflammation, Myeloid derived Suppressor Cell, Signal Transduction
Formulation	PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)	942
Isotype	IgG
Purification Method	Affinity purified

Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	Activation B7-2 antigen, B70, B7-2, B7-2 antigen, B-lymphocyte activation antigen B7-2, BU63, CD28 antigen ligand 2, CD28LG2B7-2 antigen), CD86 antigen, CD86 molecule, CTLA-4 counter-receptor B7.2, FUN-1, LAB72, MGC34413, T-lymphocyte activation antigen CD86
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: GTNTMEREESEQTKKREKIHIPERSDEAQRV
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

B7-2/CD86 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents