Learn More
Description
Specifications
Specifications
| Antigen | B7-H2/ICOSLG |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | B7H2B7 homolog 2, B7-H2B7-related protein 1, B7RP1B7-like protein Gl50, B7RP-1LICOS, CD275, CD275 antigen, GL50transmembrane protein B7-H2 ICOS ligand, ICOSL, ICOS-L, inducible T-cell co-stimulator ligand, KIAA0653ICOS ligand |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT |
| Purification Method | Protein A purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
