Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

B7-H2/ICOSLG Antibody, Novus Biologicals™
SDP

Catalog No. NB393000 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393000 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB393000 Supplier Novus Biologicals Supplier No. NBP26860625UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

B7-H2/ICOSLG Polyclonal specifically detects B7-H2/ICOSLG in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen B7-H2/ICOSLG
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias B7H2B7 homolog 2, B7-H2B7-related protein 1, B7RP1B7-like protein Gl50, B7RP-1LICOS, CD275, CD275 antigen, GL50transmembrane protein B7-H2 ICOS ligand, ICOSL, ICOS-L, inducible T-cell co-stimulator ligand, KIAA0653ICOS ligand
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 23308
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.