BACE-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162416

Catalog No. NBP162416

Description

BACE-1 Polyclonal specifically detects BACE-1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BACE-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: APP beta-secretase, ASP2, Aspartyl protease 2, BACEAsp 2, beta-secretase 1, beta-secretase 1 precursor variant 1, beta-site amyloid beta A4 precursor protein-cleaving enzyme, Beta-site amyloid precursor protein cleaving enzyme 1, Beta-site APP cleaving enzyme 1, beta-site APP-cleaving enzyme, beta-site APP-cleaving enzyme 1, EC 3.4.23, EC 3.4.23.46, FLJ90568, HSPC104, KIAA1149, Memapsin-2, Membrane-associated aspartic protease 2, transmembrane aspartic proteinase Asp2
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 2-10 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P56817
• Gene Symbols: BACE1
• Immunogen: Synthetic peptides corresponding to BACE1/beta-secretase 1 (beta-site APP-cleaving enzyme 1) The peptide sequence was selected from the N terminal of BACE1/beta-secretase 1 (NP_036236). Peptide sequence GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23621
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only