Bad Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238947

Catalog No. NBP238947

Description

Bad Polyclonal specifically detects Bad in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Bad
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q92934
• Gene Symbols: BAD
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
• Quantity: 0.1 mL
• Research Discipline: Angiogenesis, Apoptosis, Cancer, Death Receptor Signaling Pathway, GPCR, Neuroscience, Tumor Suppressors
• Gene ID (Entrez): 572
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BBC2, BBC6, bcl2 antagonist of cell death, BCL2-antagonist of cell death protein, BCL2-associated agonist of cell death, Bcl-2-binding component 6, BCL2-binding component 6, BCL2-binding protein, Bcl2-L-8, BCL2L8bcl2-L-8, Bcl-2-like protein 8, BCL-X/BCL-2 binding protein, Bcl-XL/Bcl-2-associated death promoter
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.