Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Bad Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Bad |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Bad Polyclonal specifically detects Bad in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Bad | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q92934 | |
| 572 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Apoptosis, Cancer, Death Receptor Signaling Pathway, GPCR, Neuroscience, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BBC2, BBC6, bcl2 antagonist of cell death, BCL2-antagonist of cell death protein, BCL2-associated agonist of cell death, Bcl-2-binding component 6, BCL2-binding component 6, BCL2-binding protein, Bcl2-L-8, BCL2L8bcl2-L-8, Bcl-2-like protein 8, BCL-X/BCL-2 binding protein, Bcl-XL/Bcl-2-associated death promoter | |
| BAD | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title