Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. BAT3/BAG6 Antibody, Novus Biologicals™

BAT3/BAG6 Antibody, Novus Biologicals™
SDP

Catalog No. NB396714 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396714 25 μL
NBP238693 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396714 Supplier Novus Biologicals Supplier No. NBP23869325UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

BAT3/BAG6 Polyclonal specifically detects BAT3/BAG6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen BAT3/BAG6
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Flow Cytometry 1:10-1:1000, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1:10 - 1:500, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P46379
Gene Alias BAT3HLA-B associated transcript-3, BCL2-associated athanogene 6BAG-6, D6S52EHLA-B-associated transcript 3, G3BAG family molecular chaperone regulator 6, HLA-B associated transcript 3, large proline-rich protein BAT3, Protein G3, Protein Scythe, scythe
Gene Symbols BAG6
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7917
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.