Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BAZ2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$331.00
Specifications
Antigen | BAZ2A |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BAZ2A Polyclonal specifically detects BAZ2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
BAZ2A | |
Polyclonal | |
Rabbit | |
Human | |
bromodomain adjacent to zinc finger domain protein 2A, bromodomain adjacent to zinc finger domain, 2A, DKFZp781B109, FLJ45876, hWALp3, KIAA0314FLJ13768, Tip5, TIP5FLJ13780, Transcription termination factor I-interacting protein 5, TTF-I interacting peptide 5, TTF-I-interacting protein 5, WALp3 | |
BAZ2A | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
11176 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLEVPLTASVTSPKASPVTSPAAAFPTASPANKDVSSFLETTADVEEITGEGLTASGSGDVMRRRIATPEEVRLPLQHGWRREVRIKKGSHR | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title