BBS10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168993

Catalog No. NBP168993

Description

BBS10 Polyclonal specifically detects BBS10 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BBS10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Bardet-Biedl syndrome 10, Bardet-Biedl syndrome 10 protein, FLJ23560C12orf58chromosome 12 open reading frame 58
• Host Species: Rabbit
• Molecular Weight of Antigen: 81 kDa
• Quantity: 100 μL
• Research Discipline: Vision
• Gene ID (Entrez): 79738
• Target Species: Human, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TAM1
• Gene Symbols: BBS10
• Immunogen: Synthetic peptides corresponding to BBS10 (Bardet-Biedl syndrome 10) The peptide sequence was selected from the C terminal of BBS10. Peptide sequence SQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.