BCA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25722625UL

Catalog No. NB435401

Description

BCA3 Polyclonal specifically detects BCA3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: BCA3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: AKIP1koyt binding protein 2, BCA3koyt binding protein 3, breast cancer associated gene 3, Breast cancer-associated gene 3 protein, chromosome 11 open reading frame 17, koyt binding protein 1, PKA-interacting protein, proline-rich protein BCA3, protein kinase A-interacting protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56672
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AKIP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

For Research Use Only